PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G08160.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 975aa    MW: 106748 Da    PI: 4.8896
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G08160.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.6e-1244791248
                     HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     l++av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  OMERI01G08160.2 44 LKRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 79
                     789******************.************986 PP

2Myb_DNA-binding62.49.4e-2085131148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  OMERI01G08160.2  85 KGPWSKEEDEIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 131
                      79******************************.*************97 PP

3Myb_DNA-binding48.52e-15137179145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  OMERI01G08160.2 137 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 179
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.7E-63281IPR001005SANT/Myb domain
SuperFamilySSF466894.16E-143994IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-194496IPR009057Homeodomain-like
CDDcd001672.54E-94479No hitNo description
PfamPF002491.3E-94479IPR001005SANT/Myb domain
PROSITE profilePS500907.3064479IPR017877Myb-like domain
PROSITE profilePS5129431.18380135IPR017930Myb domain
SuperFamilySSF466898.99E-3182178IPR009057Homeodomain-like
SMARTSM007173.2E-1884133IPR001005SANT/Myb domain
PfamPF002491.2E-1785131IPR001005SANT/Myb domain
CDDcd001675.86E-1687131No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2597138IPR009057Homeodomain-like
SMARTSM007172.2E-14136184IPR001005SANT/Myb domain
PROSITE profilePS5129419.815136186IPR017930Myb domain
PfamPF002496.4E-14137180IPR001005SANT/Myb domain
CDDcd001674.05E-11139179No hitNo description
Gene3DG3DSA:1.10.10.609.9E-22139186IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 975 aa     Download sequence    Send to blast
MESLLDLRRL LKKEKSATNQ KGDDLSMGGL PVRHGVPPKE IGPLKRAVQT YNGKNWKKIA  60
ECFPDRTDVQ CLHRWQKVLN PELVKGPWSK EEDEIIVQMV NKLGPKKWST IAQALPGRIG  120
KQCRERWYNH LNPGINKEAW TQEEEITLIH AHRMYGNKWA ELTKFLPGRT DNSIKNHWNS  180
SVKKKVNSYM SSGLLTQVSC LPLNEYSANC NSSPAMTQQN SEDSGCFAVR EVENSSGCSQ  240
SSLAKVSCSQ VHDNTVPLGC DLHVNANFDK NEAHDSQSSM GSEACYTSAE AVASALPAVH  300
CHVSSSNLDP DQHLQEDFAQ GLNLDMTIDE MPTVPSFADN QTVCSIENHE RSLEPYDVAM  360
EVPLSMLSSD SGAEQKLHFM SEADFNSPNC LKSELWQDIS LQGLLSGPDA VEADSFSRSN  420
HQSDVYSSEA DTHFLAPPYM PQALNSSSVM GVADDQSPQM SVPPSLICSN VMTDDAPFDN  480
RPGRKEMPLS QAEVVTQSSS SSGDAEMFAN PGCSNDRHVP SSTMESIPEC GDQQVTNAEE  540
PEASLEKEPS LTQSVTAPDE QDKGALFYEP PRFPSLDVPF VSCDLVTSGD LQEFSPLGIR  600
QLMHSTMNVC TPMRLWGSPS HDESTGVLLK SAAKSFICTP SILKKRHRDL LSPIPDKRIE  660
KKYGTEKDRG VSDTSSTGIQ TSSINATKDD ALITTVLRIE RSASSKSLEK KLVFSDENKE  720
NLGYTTEQTK DGQSAGNDEH MDEQTTGERS SATNVATNDD LSGNLQPAGI LIEHSGDDPI  780
SPDYGKNTMN QKLNTNVKSL SVCKEGVCAK SKPTELIVEK SSPCINVDYE YVNILADTPG  840
IKRGLESPSA WKSPWFVDMH FQGSYFTSPA DSYDALGLMK QINVQTAAAL VEAREVLASG  900
GQCDNISSDK ENTGNPDAKK EPGTTKLQTK IMAEGRVLDF ECTTPVRSSD KNAGSSLGRY  960
LSSPIPSSHL LKSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C5e-634418617159MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-634418617159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0E0BZE20.0A0A0E0BZE2_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g12860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-122myb domain protein 3r-4